Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
IGEGTYG2.7.11;Protein-serine/threonine kinases. 10
  • Domain: Protein kinase
DDEGVPSSALREICLLKELKHKNIVRL2.7.11.22;Cyclin-dependent kinase. 40
  • Domain: Protein kinase
  • Gene: CDK5
NIVRLHD2.7.11;Protein-serine/threonine kinases. 62
  • Domain: Protein kinase
DVLHSDKKLTLVFE2.7.11.22;Cyclin-dependent kinase. 68
  • Domain: Protein kinase
  • Gene: CDK5
LVFEFCD2.7.11;Protein-serine/threonine kinases. 78
  • Domain: Protein kinase
DQDLKKY2.7.11.22;Cyclin-dependent kinase. 84
  • Domain: Protein kinase
  • Gene: CDK5
VLHRDLK2.7.11;Protein-serine/threonine kinases. 122
  • Active Site D=Aspartic acid at location 126 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
HRDLKPQN2.7.11;Protein-serine/threonine kinases. 124
  • Active Site D=Aspartic acid at location 126 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
GELKLADFGLA2.7.11.22;Cyclin-dependent kinase. 138
  • Domain: Protein kinase
LADFGLA2.7.11;Protein-serine/threonine kinases. 142
  • Binding Site D=Aspartic acid at location 144 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
DFGLARA2.7.11;Protein-serine/threonine kinases. 144
  • Active Site D=Aspartic acid at location 144 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Binding Site D=Aspartic acid at location 144 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
DFGLARAFG2.7.11.22;Cyclin-dependent kinase. 144
  • Binding Site D=Aspartic acid at location 144 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
CYSAEVVTLWYRPPDVLFGAKLY2.7.11.22;Cyclin-dependent kinase. 157
  • Domain: Protein kinase
  • Gene: CDK5
VVTLWYR2.7.11;Protein-serine/threonine kinases. 162
  • Domain: Protein kinase
WSAGCIF2.7.11;Protein-serine/threonine kinases. 186
  • Domain: Protein kinase
GRPLFPG2.7.11;Protein-serine/threonine kinases. 199
  • Domain: Protein kinase
IFRLLGTP2.7.11.22;Cyclin-dependent kinase. 215
  • Domain: Protein kinase
LGTPTEE2.7.11.22;Cyclin-dependent kinase. 219
  • Domain: Protein kinase
SLVNVVPKLNATGRDLLQNLLKCNPVQRI2.7.11.22;Cyclin-dependent kinase. 247
  • Domain: Protein kinase
  • Gene: CDK5
RISAEEAL2.7.11;Protein-serine/threonine kinases. 274
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDP
EIVKSFLFQLLKGLGFCHSRN
VLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGR
PLFPG
NDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP



DME EC Prediction for this protein is: 2.7.11.22
Check another protein