Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LQKKLEEL2.7.12.2;Mitogen-activated protein kinase kinase. 33 -
ELELDEQQ2.7.12.2;Mitogen-activated protein kinase kinase. 39 -
RLEAFLTQK2.7.12.2;Mitogen-activated protein kinase kinase. 49 -
KVGELKDDDFE2.7.12.2;Mitogen-activated protein kinase kinase. 59 -
SELGAGNGGVVFKVSHKP2.7.12.2;Mitogen-activated protein kinase kinase. 72
  • Domain: Protein kinase
  • Gene: MP2K1
MARKLIHLE2.7.12.2;Mitogen-activated protein kinase kinase. 94
  • Binding Site K=Lysine at location 97 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
CNSPYIV2.7.12.2;Mitogen-activated protein kinase kinase. 121
  • Domain: Protein kinase
FYSDGEISICMEHMDGGSLDQVLK2.7.12.2;Mitogen-activated protein kinase kinase. 133
  • Domain: Protein kinase
PEQILGKV2.7.12.2;Mitogen-activated protein kinase kinase. 162
  • Domain: Protein kinase
ILGKVSIAV2.7.12.2;Mitogen-activated protein kinase kinase. 165
  • Domain: Protein kinase
GEIKLCDFGVSG2.7.12.2;Mitogen-activated protein kinase kinase. 202
  • Domain: Protein kinase
LIDSMANSFVGTRSYM2.7.12.2;Mitogen-activated protein kinase kinase. 215
  • Domain: Protein kinase
GRYPIPPPD2.7.12.2;Mitogen-activated protein kinase kinase. 259
  • Domain: Protein kinase
PIPPPDAKELE2.7.12.2;Mitogen-activated protein kinase kinase. 262
  • Domain: Protein kinase
KELELMFGC2.7.12.2;Mitogen-activated protein kinase kinase. 269
  • Domain: Protein kinase
  • Gene: MP2K1
MAIFELLDYIVNEPP2.7.12.2;Mitogen-activated protein kinase kinase. 308
  • Domain: Protein kinase
EFQDFVNKCL2.7.12.2;Mitogen-activated protein kinase kinase. 333
  • Domain: Protein kinase
  • Gene: MP2K1
KNPAERADLK2.7.12.2;Mitogen-activated protein kinase kinase. 344
  • Domain: Protein kinase
HAFIKRS2.7.12.2;Mitogen-activated protein kinase kinase. 358
  • Domain: Protein kinase
VDFAGWLC2.7.12.2;Mitogen-activated protein kinase kinase. 369 -
LNQPSTPT2.7.12.2;Mitogen-activated protein kinase kinase. 381 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH
LE
IKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNS
R
GEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPP
MAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV



DME EC Prediction for this protein is: 2.7.12.2
Check another protein