Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SRRWFHP3.1.3.48;Protein-tyrosine-phosphatase. 3 -
GSFLARPS3.1.3.48;Protein-tyrosine-phosphatase. 27
  • Domain: SH2
VTHIKIQN3.1.3.48;Protein-tyrosine-phosphatase. 51
  • Domain: SH2
ELVQYYME3.1.3.48;Protein-tyrosine-phosphatase. 76
  • Domain: SH2
LKYPLNC3.1.3.48;Protein-tyrosine-phosphatase. 98
  • Domain: SH2
DPTSERW3.1.3.48;Protein-tyrosine-phosphatase. 106 -
LSGKEAEKL3.1.3.48;Protein-tyrosine-phosphatase. 117
  • Domain: SH2
KYDVGGGE3.1.3.48;Protein-tyrosine-phosphatase. 178
  • Domain: SH2
FDSLTDLVEH3.1.3.48;Protein-tyrosine-phosphatase. 187
  • Domain: SH2
GFWEEFE3.1.3.48;Protein-tyrosine-phosphatase. 246 -
KNRYKNILP3.1.3.48;Protein-tyrosine-phosphatase. 276
  • Domain: Tyrosine-protein pho
QENSRVIVMTT3.1.3.48;Protein-tyrosine-phosphatase. 347
  • Domain: Tyrosine-protein pho
VIVMTTKEVERG3.1.3.48;Protein-tyrosine-phosphatase. 352
  • Domain: Tyrosine-protein pho
WPDHGVP3.1.3.48;Protein-tyrosine-phosphatase. 427
  • Domain: Tyrosine-protein pho
GPVVVHCS3.1.3.48;Protein-tyrosine-phosphatase. 457
  • Active Site C=Cysteine at location 463 on the protein
  • Active Site Description: Phosphocysteine intermediate (
  • Domain: Tyrosine-protein pho
VVHCSAG3.1.3.48;Protein-tyrosine-phosphatase. 460
  • Active Site C=Cysteine at location 463 on the protein
  • Active Site Description: Phosphocysteine intermediate (
  • Domain: Tyrosine-protein pho
HCSAGIGR3.1.3.48;Protein-tyrosine-phosphatase. 462
  • Active Site C=Cysteine at location 463 on the protein
  • Active Site Description: Phosphocysteine intermediate (
  • Domain: Tyrosine-protein pho
QRSGMVQT3.1.3.48;Protein-tyrosine-phosphatase. 504
  • Domain: Tyrosine-protein pho
VQTEAQY3.1.3.48;Protein-tyrosine-phosphatase. 509
  • Domain: Tyrosine-protein pho
DQTSGDQSPLPPCTPTP3.1.3.48;Protein-tyrosine-phosphatase. 555
  • Gene: PTN11

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKY
PLNC
ADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKN
PMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVKQ
GFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVF
QENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRE
LKLSKVGQALLQGNTERTVWQYHFRT
WPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGVDCDIDVPKTIQM
VRS
QRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR



DME EC Prediction for this protein is: 3.1.3.48
Check another protein