Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
EECGVFG2.4.2.14;Amidophosphoribosyltransferase. 10
  • Active Site C=Cysteine at location 12 on the protein
  • Active Site Description: For GATase activity (By simila
  • Gene: PUR1
LQHRGQE2.4.2.14;Amidophosphoribosyltransferase. 40
  • Domain: Glutamine amidotrans
  • Gene: PUR1
YGNRPLCIG2.4.2.14;Amidophosphoribosyltransferase. 201
  • Domain: Glutamine amidotrans
  • Gene: PUR1
FEYVYFAR2.4.2.14;Amidophosphoribosyltransferase. 282
  • Gene: PUR1
YFARPDS2.4.2.14;Amidophosphoribosyltransferase. 286
  • Gene: PUR1
YVGRTFI2.4.2.14;Amidophosphoribosyltransferase. 352
  • Gene: PUR1
RLRQLGVAKKFG2.4.2.14;Amidophosphoribosyltransferase. 363
  • Gene: PUR1
EVHIRVASP2.4.2.14;Amidophosphoribosyltransferase. 412
  • Gene: PUR1
GHCTACLTG2.4.2.14;Amidophosphoribosyltransferase. 501
  • Metal Site C=Cysteine at location 503 on the protein
  • Metal Site Description: Iron-sulfur (4Fe-4S) (By simil
  • Gene: PUR1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC
ELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLIMHRDVIYAVRDP
YGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVY
TVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNR
YVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISP
IIKLLKESGAK
EVHIRVASPPIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQENGNGLECFEKS
GHCTACLTGKYPVELEW



DME EC Prediction for this protein is: 2.4.2.14
Check another protein