Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GWLNGSLVGFY3.4.11.7;Glutamyl aminopeptidase. 194
  • Gene: AMPE
ARKSFPCFDEP3.4.11;Aminopeptidases. 227 -
KSVPMSTYLVCFAVH3.4.11.7;Glutamyl aminopeptidase. 278
  • Gene: AMPE
TAEYAANIT3.4.11.7;Glutamyl aminopeptidase. 318
  • Gene: AMPE
LPKLDKIAIPDFGTGAMENWGL3.4.11.7;Glutamyl aminopeptidase. 343
  • Gene: AMPE
GAMENWG3.4.11;Aminopeptidases. 357 -
TYRETNLLYDP3.4.11.7;Glutamyl aminopeptidase. 366
  • Gene: AMPE
WLNEGFA3.4.11;Aminopeptidases. 413
  • Metal Site E=Glutamic acid at location 416 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
EITSVFDGISYSKG3.4.11.7;Glutamyl aminopeptidase. 469
  • Active Site Y=Tyrosine at location 479 on the protein
  • Active Site Description: Proton donor (Potential).
  • Gene: AMPE
NAKTSDFW3.4.11.7;Glutamyl aminopeptidase. 513
  • Gene: AMPE
PVKEVMDTWT3.4.11.7;Glutamyl aminopeptidase. 530
  • Gene: AMPE
GFYRVNY3.4.11.7;Glutamyl aminopeptidase. 625 -
IDDAFALARAQLL3.4.11.7;Glutamyl aminopeptidase. 659
  • Gene: AMPE
YIISMFEDD3.4.11.7;Glutamyl aminopeptidase. 701
  • Gene: AMPE
QVKPIADSLGW3.4.11.7;Glutamyl aminopeptidase. 723
  • Gene: AMPE
PVNLRLLVYRYGMQNSGNE3.4.11.7;Glutamyl aminopeptidase. 779
  • Gene: AMPE
KPREQVLETVKNNIEWL3.4.11.7;Glutamyl aminopeptidase. 923
  • Gene: AMPE

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHLPSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPV
HYDLHVKPLLEEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPSSGDGLYLLTMEFA
GWLNGSL
VGFY
RTTYTENGQVKSIVATDHEPTDARKSFPCFDEPNKKATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRI
SNSGKPLTIYVQPEQKH
TAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDFGTGAMENWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWF
GNIVTMDWWEDL
WLNEGFASFFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYSKGSSILRMLEDWIKPENFQK
GCQMYLEKYQFK
NAKTSDFWAALEEASRLPVKEVMDTWTRQMGYPVLNVNGVKNITQKRFLLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSE
KEGITLNSSNPSGNAFLKINPDHI
GFYRVNYEVATWDSIATALSLNHKTFSSADRASLIDDAFALARAQLLDYKVALNLTKYLKREENFLPWQRVISAVT
YIISMFEDDKELYPMIEEYFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPVNLRLLVYRYGMQNSGNEISW
NYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFN
TELQLWQMESFFAKYPQAGAGE
KPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG



DME EC Prediction for this protein is: 3.4.11.7
Check another protein