Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GDGAWCP2.7.10.1;Receptor protein-tyrosine kinase. 69
  • Domain: F5/8 type C
LVGTQGRHAGG2.7.10.1;Receptor protein-tyrosine kinase. 99
  • Domain: F5/8 type C
VWPGYDYVGW2.7.10.1;Receptor protein-tyrosine kinase. 249 -
GYVEMEFEFDRLR2.7.10.1;Receptor protein-tyrosine kinase. 266
  • Gene: DDR1
ILIGCLVAII2.7.10.1;Receptor protein-tyrosine kinase. 418 -
PPRGPGPP2.7.10;Protein-tyrosine kinases. 523 -
LQGVTGGNTY2.7.10.1;Receptor protein-tyrosine kinase. 577 -
KNARNDFLKE2.7.10.1;Receptor protein-tyrosine kinase. 663
  • Domain: Protein kinase
DPLCMIT2.7.10.1;Receptor protein-tyrosine kinase. 695
  • Domain: Protein kinase
YMENGDLNQFL2.7.10.1;Receptor protein-tyrosine kinase. 703
  • Domain: Protein kinase
FVHRDLA2.7.10;Protein-tyrosine kinases. 762
  • Active Site D=Aspartic acid at location 766 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
FVHRDLATRNC2.7.10.1;Receptor protein-tyrosine kinase. 762
  • Active Site D=Aspartic acid at location 766 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
HRDLATRN2.7.10;Protein-tyrosine kinases. 764
  • Active Site D=Aspartic acid at location 766 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
QGRAVLPIRWM2.7.10.1;Receptor protein-tyrosine kinase. 800
  • Domain: Protein kinase
SDVWAFGVT2.7.10.1;Receptor protein-tyrosine kinase. 824
  • Domain: Protein kinase
GEFFRDQGRQ2.7.10.1;Receptor protein-tyrosine kinase. 858
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALV
GTQGRHAGG
LGKEFSRSYRLRYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQ
TMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELR
VWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG
VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLEL
EPRGQQPVAKAEGSPTA
ILIGCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPRGNPPHSAPCV
PNGSALLLSNPAYRLLLATYAR
PPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGP
PRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDAT
KNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMI
T
DYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQ
GRAVLPIRWM
AWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQ
LHRFLAEDALNTV



DME EC Prediction for this protein is: 2.7.10.1
Check another protein