Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DIESILALNPR1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 11
  • Gene: DPYD
CEKLENNF1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 52
  • Gene: DPYD
RCLKCADAPCQK1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 78
  • Domain: 4Fe-4S ferredoxin-ty
  • Gene: DPYD
LDIKSFI1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 95
  • Domain: 4Fe-4S ferredoxin-ty
  • Gene: DPYD
KSFITSI1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 98
  • Domain: 4Fe-4S ferredoxin-ty
  • Gene: DPYD
SDNPLGLTCGM1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 118
  • Gene: DPYD
CPTSDLCVG1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 130
  • Gene: DPYD
EEGPINIGGLQQFATEVF1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 146
  • Gene: DPYD
IPQIRNP1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 168
  • Gene: DPYD
GPASISCASFLARLGY1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 196
  • Gene: DPYD
GYKAAFIGIGLPEP1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 275
  • Gene: DPYD
QGFYTSKDFLPLVAK1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 301
  • Gene: DPYD
VIVLGAGDTAFDCATSA1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 335
  • Gene: DPYD
DCATSALRCGA1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 346
  • Gene: DPYD
LKADVVISAFGSVL1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 429
  • Gene: DPYD
WVFAGGD1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 475
  • Gene: DPYD
ANTTVESVNDGKQASW1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 486
  • Gene: DPYD
NPFGLASA1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 544
  • Gene: DPYD
MIRRAFE1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 559
  • Gene: DPYD
GWGFALTKTF1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 567
  • Gene: DPYD
TKTFSLDKD1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 573
  • Gene: DPYD
VTNVSPRI1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 583
  • Gene: DPYD
NIELISEK1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 609
  • Gene: DPYD
ELKADFP1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 627
  • Gene: DPYD
IASIMCSYN1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 638
  • Gene: DPYD
ELNLSCPHGMGE1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 666
  • Gene: DPYD
GMGLACGQ1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 679
  • Gene: DPYD
GVTATNTVS1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 731
  • Gene: DPYD
NTVSGLMGLK1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 736
  • Gene: DPYD
RTTYGGVSGTAIRPIALRAVT1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 759
  • Gene: DPYD
FPILATGGIDSAESGLQFLH1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 788
  • Gene: DPYD
GASVLQVCSA1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 809
  • Gene: DPYD
QNQDFTV1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 820
  • Gene: DPYD
DYCTGLKALLYL1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 829
  • Gene: DPYD
GLKALLYLKSIEEL1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 833
  • Gene: DPYD
LQYLGTFGE1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 929
  • Gene: DPYD
CINCGKCYMTCNDSGYQAI1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 953
  • Metal Site C=Cysteine at location 953 on the protein
  • Metal Site Description: Iron-sulfur 1 (4Fe-4S) (Potent
  • Domain: 4Fe-4S ferredoxin-ty
  • Gene: DPYD
FDPETHLP1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 973
  • Domain: 4Fe-4S ferredoxin-ty
  • Gene: DPYD
CTGCTLCLSVCPI1.3.1.2;Dihydropyrimidine dehydrogenase (NADP(+)). 986
  • Metal Site C=Cysteine at location 986 on the protein
  • Metal Site Description: Iron-sulfur 2 (4Fe-4S) (Potent
  • Domain: 4Fe-4S ferredoxin-ty
  • Gene: DPYD

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCFNCEKLENNFDDIKHTTLGERGALREAMRCLKCADAPCQKSCPTNLDIKSF
ITSI
ANKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEEGPINIGGLQQFATEVFKAMSIPQIRNPSLPPPEKMSEAYSAKIALFGAGPASI
SCASFLARLGY
SDITIFEKQEYVGGLSTSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSVNEMTLSTLKEKGYKAAFIGIGLPEPNKDAIFQGLTQD
QGFYTSKDFLPLVAKGSKAGMCACHSPLPSIRGVVIVLGAGDTAFDCATSALRCGARRVFIVFRKGFVNIRAVPEEMELAKEEKCEFLPFLSPRKVIVKG
GRIVAMQFVRTEQDETGKWNEDEDQMVH
LKADVVISAFGSVLSDPKVKEALSPIKFNRWGLPEVDPETMQTSEAWVFAGGDVVGLANTTVESVNDGKQAS
W
YIHKYVQSQYGASVSAKPELPLFYTPIDLVDISVEMAGLKFINPFGLASATPATSTSMIRRAFEAGWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPMY
GPGQSSFL
NIELISEKTAAYWCQSVTELKADFPDNIVIASIMCSYNKNDWTELAKKSEDSGADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQ
AVQIPFFAKLTPNVTDIVSIARAAKEGGAN
GVTATNTVSGLMGLKSDGTPWPAVGIAKRTTYGGVSGTAIRPIALRAVTSIARALPGFPILATGGIDSAE
SGLQFLH
SGASVLQVCSAIQNQDFTVIEDYCTGLKALLYLKSIEELQDWDGQSPATVSHQKGKPVPRIAELMDKKLPSFGPYLEQRKKIIAENKIRLKEQ
NVAFSPLKRNCFIPKRPIPTIKDVIGKA
LQYLGTFGELSNVEQVVAMIDEEMCINCGKCYMTCNDSGYQAIQFDPETHLPTITDTCTGCTLCLSVCPIVD
CIKMVSRTTPYEPKRGVPLSVNPVC



DME EC Prediction for this protein is: 1.3.1.2
Check another protein