Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
ENEIAVL2.7.11.17;Calcium/calmodulin-dependent protein kinase. 64
  • Domain: Protein kinase
MQLVSGGELFDRI2.7.11.17;Calcium/calmodulin-dependent protein kinase. 95
  • Domain: Protein kinase
GGELFDR2.7.11;Protein-serine/threonine kinases. 100
  • Domain: Protein kinase
IVHRDLK2.7.11;Protein-serine/threonine kinases. 137
  • Active Site R=Arginine at location 140 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
VHRDLKP2.7.11;Protein-serine/threonine kinases. 138
  • Active Site R=Arginine at location 140 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLKPEN2.7.11;Protein-serine/threonine kinases. 140
  • Active Site D=Aspartic acid at location 141 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
LKPENLL2.7.11;Protein-serine/threonine kinases. 142
  • Domain: Protein kinase
SKIMISDFGLSKME2.7.11.17;Calcium/calmodulin-dependent protein kinase. 156
  • Domain: Protein kinase
STACGTPGYVAPEVLAQKPYSKAVDCWSIGVI2.7.11.17;Calcium/calmodulin-dependent protein kinase. 176
  • Domain: Protein kinase
YVAPEVL2.7.11;Protein-serine/threonine kinases. 184
  • Domain: Protein kinase
KLFEQILKAEYEFDSPYWDDISDSAKDFIR2.7.11.17;Calcium/calmodulin-dependent protein kinase. 225
  • Domain: Protein kinase
ISDSAKD2.7.11;Protein-serine/threonine kinases. 245
  • Domain: Protein kinase
KNFAKSKW2.7.11.17;Calcium/calmodulin-dependent protein kinase. 296 -
QAFNATAVVRHMR2.7.11.17;Calcium/calmodulin-dependent protein kinase. 305 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSG
GELFDRI
VEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVD
CWSIGVI
AYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKW
KQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGTELSPTLPHQL



DME EC Prediction for this protein is: 2.7.11.17
Check another protein