Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KHCFNAFASDRISL2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 147 -
LGPDTRPPEC2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 164 -
TSVIIVFHNE2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 187 -
FHNEAWS2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 193 -
LLRTVHS2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 201 -
LLKEIILVDD2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 216 -
ERKGLITARLLGA2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 253 -
GWLEPLL2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 285 -
WLEPLLARI2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 286 -
AGGLFSI2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 363 -
SFRVWQCGG2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 395 -
RLAEVWMD2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 438 -
AEVWMDEYK2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 440 -
CLDVGENN2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 517
  • Domain: Ricin B-type lectin
CHGLGGNQ2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 535
  • Domain: Ricin B-type lectin

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQG
YYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEA
KHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWST
LLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKLDEYVKQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTA
VVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTPTF
AGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQ
CGG
QLEIMPCSVVGHVFRSKSPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFTWYLNNIYPEVYVPD
LNPVISGYIKSVGQPL
CLDVGENNQGGKPLIMYTCHGLGGNQYFEYSAQHEIRHNIQKELCLHAAQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYNP
FLKMCLSANGEHPSLVSCNPSDPLQKWILSQND



DME EC Prediction for this protein is: 2.4.1.41
Check another protein