Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TFASGKTEK3.1.4.11;Phosphoinositide phospholipase C. 172 -
RYLMSDENAPVFLDRL3.1.4.11;Phosphoinositide phospholipase C. 294 -
SSHNTYL3.1.4.11;Phosphoinositide phospholipase C. 326
  • Active Site H=Histidine at location 328 on the protein
  • Active Site Description: By similarity.
  • Metal Site N=Asparagine at location 329 on the protein
  • Metal Site Description: Calcium 1; catalytic (By simil
  • Domain: PI-PLC X-box
SSVEMYRQ3.1.4.11;Phosphoinositide phospholipase C. 341
  • Domain: PI-PLC X-box
GCRCVELD3.1.4.11;Phosphoinositide phospholipase C. 353
  • Metal Site E=Glutamic acid at location 358 on the protein
  • Metal Site Description: Calcium 1; catalytic (By simil
  • Domain: PI-PLC X-box
SEYPVILS3.1.4.11;Phosphoinositide phospholipase C. 400
  • Domain: PI-PLC X-box
YNKRQMSR3.1.4.11;Phosphoinositide phospholipase C. 614
  • Domain: PI-PLC Y-box
RVDSSNY3.1.4.11;Phosphoinositide phospholipase C. 628
  • Domain: PI-PLC Y-box
DSSNYMPQ3.1.4.11;Phosphoinositide phospholipase C. 630
  • Domain: PI-PLC Y-box
MQLNQGKFEYNG3.1.4.11;Phosphoinositide phospholipase C. 658
  • Domain: PI-PLC Y-box
CGYLLKPDFMRR3.1.4.11;Phosphoinositide phospholipase C. 671
  • Domain: PI-PLC Y-box
PVDGVIAA3.1.4.11;Phosphoinositide phospholipase C. 694
  • Domain: C2
ISGQFLS3.1.4.11;Phosphoinositide phospholipase C. 708
  • Domain: C2
VEVDMYGLP3.1.4.11;Phosphoinositide phospholipase C. 722
  • Domain: C2
NNGLNPVYNE3.1.4.11;Phosphoinositide phospholipase C. 745
  • Domain: C2
GQRILPLDGLQAGYRH3.1.4.11;Phosphoinositide phospholipase C. 783
  • Domain: C2
KQNEQAK3.1.4.11;Phosphoinositide phospholipase C. 1149 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCV
CSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITR
TFASGKTEKVIFQALKELGLPSGKNDEIE
PTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFC
RYLMSDE
NAPVFLDRL
ELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTS
EYPVILS
FENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRSMMEAGESASPANILEDDNEEE
IESADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVN
YNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIA
A
TCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHIS
LRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAA
LASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEI
KIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNK
AERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQLEHLEFLE
KQNEQAKEMQQMVKLEAEMDRRPATVV



DME EC Prediction for this protein is: 3.1.4.11
Check another protein