Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data

Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SVGMDTFIHRIDSTEVIYQPRRKRAKL2.7.11.1;Non-specific serine/threonine protein kinase. 19
  • Gene: STK11
LHSQGIVH2.7.11.1;Non-specific serine/threonine protein kinase. 167
  • Domain: Protein kinase
GTLKISDLGVAEALHPFA2.7.11.1;Non-specific serine/threonine protein kinase. 188
  • Domain: Protein kinase
  • Gene: STK11
GSPAFQPPE2.7.11.1;Non-specific serine/threonine protein kinase. 215
  • Domain: Protein kinase
  • Gene: STK11
DIWSAGV2.7.11.1;Non-specific serine/threonine protein kinase. 237
  • Domain: Protein kinase
IIYTQDFTVPGQV2.7.11.1;Non-specific serine/threonine protein kinase. 360
  • Gene: STK11

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQ
LLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEA
LHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI
RQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQL
STKSRAEGRAPNPARKACSASSKIRRLSACKQQ


DME EC Prediction for this protein is: 2.7.11.1
Check another protein