Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
ELKVKQGAENM2.7.11.13;Protein kinase C. 148 -
SNGSSKD2.7.11;Protein-serine/threonine kinases. 163 -
LQDSKTKI2.7.11.13;Protein kinase C. 180 -
EELRHHF2.7.11.13;Protein kinase C. 220 -
AVAEGAKNV2.7.11.13;Protein kinase C. 231 -
ESSQKLDLL2.7.11.13;Protein kinase C. 263 -
YSTLSKPA2.7.11.13;Protein kinase C. 318 -
LEDFLDN2.7.11.13;Protein kinase C. 451
  • Domain: C2
PVIERRP2.7.11.13;Protein kinase C. 481 -
AVLGRGHFGKVLL2.7.11.13;Protein kinase C. 661
  • Domain: Protein kinase
FAIKALKK2.7.11.13;Protein kinase C. 683
  • Binding Site K=Lysine at location 686 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
ACVVLGLQ2.7.11.13;Protein kinase C. 764
  • Domain: Protein kinase
YRDLKLDN2.7.11.13;Protein kinase C. 780
  • Active Site D=Aspartic acid at location 782 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLKLDN2.7.11;Protein-serine/threonine kinases. 781
  • Active Site D=Aspartic acid at location 782 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
DFGLCKE2.7.11;Protein-serine/threonine kinases. 800
  • Domain: Protein kinase
TSTFCGTPEF2.7.11.13;Protein kinase C. 814
  • Domain: Protein kinase
RAVDWWGLGV2.7.11;Protein-serine/threonine kinases. 836
  • Domain: Protein kinase
LGVLIYEM2.7.11;Protein-serine/threonine kinases. 843
  • Domain: Protein kinase
EFTSEAP2.7.11.13;Protein kinase C. 949
  • Domain: AGC-kinase C-termina

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKELKIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKL
QELNAHIVVSDPEDITDCPRTPDTPNNDPRCSTSNNRLKALQKQLDI
ELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLLQDSKTKIEVIRMQILQAVQT
NELAFDNAKPVISPLELRM
EELRHHFRIEFAVAEGAKNVMKLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNEVPKNHPKSRIIIEELSLVA
ASPTLSPRQSMISTQNQ
YSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWSPSETRSSFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLD
NTVVGQTSWKPISNQSWDQKFTLELDRSRELEISVYWRDWRSLCAVKFLR
LEDFLDNQRHGMCLYLEPQGTLFAEVTFFNPVIERRPKLQRQKKIFSKQQ
GKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPVPTTVPVVDVRIPQLAPPASDSTVTKLDFDLEPEPPPAPPRASSLGEIDESSELRVLDIPG
QDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCC
AVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVD
SLMCEKRIFETVNSVRHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYA
ACVVLGLQYLHEHKIVYRDLKLDNLLLDTEGFVKIAD
FGLCKE
GMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRL
GASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDD
EFTSEAPILTPPREPRILSEEEQEMFRDFDYIADWC



DME EC Prediction for this protein is: 2.7.11.13
Check another protein