Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
ICETAMG1.14.14.1;Unspecific monooxygenase. 200 -
DIREEVDTFMFEGHDTT1.14.14.1;Unspecific monooxygenase. 318
  • Binding Site E=Glutamic acid at location 329 on the protein
  • Binding site description: Heme (covalent; via 1 link) (B
RLFPSVP1.14.14.1;Unspecific monooxygenase. 390 -
PFSAGPRNCIGQKFA1.14.14.1;Unspecific monooxygenase. 459
  • Metal Site C=Cysteine at location 467 on the protein
  • Metal Site Description: Iron (heme axial ligand) (By s

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMV
ALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDI
I
CETAMG
KNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLQILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFL
DLLLSVTDDEGNRLSHE
DIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFAR
SVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYV
PFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELG
LEGQLILRPSNGIWIKLKRRNADER



DME EC Prediction for this protein is: 1.14.14.1
Check another protein