Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LLMATTRTGSSFVGEFFNQ2.8.2.17;Chondroitin 6-sulfotransferase. 136
  • Gene: CHST3
IFYLFEPLWH2.8.2.17;Chondroitin 6-sulfotransferase. 158
  • Gene: CHST3
GSALVYRDVL2.8.2.17;Chondroitin 6-sulfotransferase. 183
  • Gene: CHST3
LVRDPRAV2.8.2.17;Chondroitin 6-sulfotransferase. 299 -
EVQRLRGNCE2.8.2.17;Chondroitin 6-sulfotransferase. 337
  • Gene: CHST3
YMLVRYED2.8.2;Sulfotransferases. 366 -
SSEQFEKWR2.8.2.17;Chondroitin 6-sulfotransferase. 421
  • Gene: CHST3

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEKGLTLPQDCRDFVHSLKMRSKYALFLVFVVIVFVFIEKENKIISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQ
LGVEPAMEAAGEEEEEQRKEEEPPRPAVAGPRRHV
LLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGANAAGSALVYRDVLKQLFLCDL
YVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKKVFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLDLRVIQ
LV
RDPRAV
LASRMVAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDW
IQKNTQAAHDGSGIYSTQKN
SSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKLARDAAALTNRSVSLLEERGTFWVT



DME EC Prediction for this protein is: 2.8.2.17
Check another protein