Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RPTGSPPVW3.1.1;Carboxylic ester hydrolases. 79 -
GVSLGAH3.1.1;Carboxylic ester hydrolases. 152
  • Active Site S=Serine at location 154 on the protein
  • Active Site Description: Nucleophile (By similarity).
GRITGLD3.1.1.3;Triacylglycerol lipase. 172 -
GLDPAGP3.1.1;Carboxylic ester hydrolases. 176
  • Active Site D=Aspartic acid at location 178 on the protein
  • Active Site Description: Charge relay system (By simila
RLDPSDA3.1.1.3;Triacylglycerol lipase. 192 -
DFYPNGG3.1.1.3;Triacylglycerol lipase. 221 -
YFKCDHQ3.1.1;Carboxylic ester hydrolases. 243
  • Active Site H=Histidine at location 248 on the protein
  • Active Site Description: Charge relay system (By simila

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLRFYLFISLLCLSRSDAEETCPSFTRLSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSSAFGNLNVTKKTTFIVHGFRPTGSPPVWMDDLVKGLLSVED
MNVVVVDWNRGATTLIYTHASSKTRKVAMVLKEFIDQMLAEGASLDDIYMI
GVSLGAHISGFVGEMYDGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQF
VDVIHSDTDALGYKEPLGNI
DFYPNGGLDQPGCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYAD
NWKDHLRGKDPPMTKAFFDTAEESPFCMYHYFVDIITWNKNVRRGDITIKLRDKAGNTTESKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGS
LIGPRYKLRILRMKLRSLAHPERPQLCRYDLVLMENVETVFQPILCPELQL



DME EC Prediction for this protein is: 3.1.1.3
Check another protein