Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
YLSGINSWKKRLIRIKNGILRGVYPGSPTSWLVV2.3.1.21;Carnitine O-palmitoyltransferase. 32
  • Gene: CPT1B
PMLYSFQTSLP2.3.1.21;Carnitine O-palmitoyltransferase. 164 -
YLESVRP2.3.1.21;Carnitine O-palmitoyltransferase. 188 -
NYVSDWWEE2.3.1.21;Carnitine O-palmitoyltransferase. 232 -
IKPVMALG2.3.1.21;Carnitine O-palmitoyltransferase. 293
  • Gene: CPT1B
FNTTRIPG2.3.1.21;Carnitine O-palmitoyltransferase. 313 -
VYHKGRF2.3.1.21;Carnitine O-palmitoyltransferase. 337 -
FFSSGKNK2.3.1.21;Carnitine O-palmitoyltransferase. 399
  • Gene: CPT1B
RWFDKSF2.3.1.21;Carnitine O-palmitoyltransferase. 451 -
WADAPIIGHLWEFVL2.3.1.21;Carnitine O-palmitoyltransferase. 475
  • Gene: CPT1B
FGKGLIKKCRTSPDAF2.3.1.21;Carnitine O-palmitoyltransferase. 554 -
SPDAFVQ2.3.1;Transferring groups other than amino-acyl groups. 565 -
GKFCLTYEASMTR2.3.1.21;Carnitine O-palmitoyltransferase. 583
  • Binding Site Y=Tyrosine at location 589 on the protein
  • Binding site description: Carnitine (By similarity).
FREGRTETVRSC2.3.1.21;Carnitine O-palmitoyltransferase. 597
  • Binding Site T=Threonine at location 602 on the protein
  • Binding site description: Carnitine (By similarity).
YRLAMTG2.3.1.21;Carnitine O-palmitoyltransferase. 644 -
EVLSEPW2.3.1.21;Carnitine O-palmitoyltransferase. 676 -
GGGFGPVAD2.3.1.21;Carnitine O-palmitoyltransferase. 709 -
GYGVSYMIAGENT2.3.1.21;Carnitine O-palmitoyltransferase. 719
  • Gene: CPT1B
SSSETNA2.3.1.21;Carnitine O-palmitoyltransferase. 741
  • Gene: CPT1B

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPTSWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQT
PQTRALLSMAIFSTGVWVTGIFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRH
PMLYSFQTSLPKLPVPRVSATIQRYLESVRPLLDDEE
YYRMELLAKEFQDKTAPRLQKYLVLKSWWAS
NYVSDWWEEYIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFF
SSGKNK
AALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPIIGHLWEFVLGTDSFHLGYTE
TGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKALADDVELYCFQFLP
FGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSC
TSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCLYLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPE
QHPNHLGA
GGGFGPVADDGYGVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS



DME EC Prediction for this protein is: 2.3.1.21
Check another protein