Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
EIGRGSF2.7.11.1;Non-specific serine/threonine protein kinase. 179
  • Domain: Protein kinase
TELMTSGTL2.7.11.1;Non-specific serine/threonine protein kinase. 254
  • Domain: Protein kinase
ILHRDLK2.7.11;Protein-serine/threonine kinases. 298
  • Active Site D=Aspartic acid at location 302 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KIGDLGLA2.7.11;Protein-serine/threonine kinases. 318
  • Domain: Protein kinase
VIGTPEFMAPE2.7.11.1;Non-specific serine/threonine protein kinase. 336
  • Domain: Protein kinase
GTPEFMAPE2.7.11;Protein-serine/threonine kinases. 338
  • Domain: Protein kinase
FGMCMLEM2.7.11.1;Non-specific serine/threonine protein kinase. 361
  • Domain: Protein kinase
EYPYSEC2.7.11.1;Non-specific serine/threonine protein kinase. 372
  • Domain: Protein kinase
PEVKEIIEGCIR2.7.11.1;Non-specific serine/threonine protein kinase. 403
  • Domain: Protein kinase
SSEESESS2.7.11.1;Non-specific serine/threonine protein kinase. 1121 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLASPATETTVLMSQTEADLALRPPPPLGTAGQPRLGPPPRRARRFSGKAEPRPRSSRLSRRSSVDLGLLSSWSLPASPAPDPPDPPDSAGPGPARSPPP
SSKEPPEGTWTEGAPVKAAEDSARPELPDSAVGPGSREPLRVPEAVALERRREQEEKEDMETQAVATSPDGRYLKFDI
EIGRGSFKTVYRGLDTDTTVEV
AWCELQTRKLSRAERQRFSEEVEMLKGLQHPNIVRFYDSWKSVLRGQVCIVLV
TELMTSGTLKTYLRRFREMKPRVLQRWSRQILRGLHFLHSRVPPILH
RDLK
CDNVFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGRKPNSFHKV
KI
PEVKEIIEGCIRTDKNERFTIQDLLAHAFFREERGVHVELAEEDDGEKPGLKLWLRMEDARRGGRPRDNQAIEFLFQLGRDAAEEVAQEMVALGLVCE
ADYQPVARAVRERVAAIQRKREKLRKARELEALPPEPGPPPATVPMAPGPPSVFPPEPEEPEADQHQPFLFRHASYSSTTSDCETDGYLSSSGFLDASDP
ALQPPGGVPSSLAESHLCLPSAFALSIPRSGPGSDFSPGDSYASDAASGLSDVGEGMGQMRRPPGRNLRRRPRSRLRVTSVSDQNDRVVECQLQTHNSKM
VTFRFDLDGDSPEEIAAAMVYNEFILPSERDGFLRRIREIIQRVETLLKRDTGPMEAAEDTLSPQEEPAPLPALPVPLPDPSNEELQSSTSLEHRSWTAF
STSSSSPGTPLSPGNPFSPGTPISPGPIFPITSPPCHPSPSPFSPISSQVSSNPSPHPTSSPLPFSSSTPEFPVPLSQCPWSSLPTTSPPTFSPTCSQVT
LSSPFFPPCPSTSSFPSTTAAPLLSLASAFSLAVMTVAQSLLSPSPGLLSQSPPAPPSPLPSLPLPPPVAPGGQESPSPHTAEVESEASPPPARPLPGEA
RLAPISEEGKPQLVGRFQVTSSKEPAEPLPLQPTSPTLSGSPKPSTPQLTSESSDTEDSAGGGPETREALAESDRAAEGLGAGVEEEGDDGKEPQVGGSP
QPLSHPSPVWMNYSYSSLCL
SSEESESSGEDEEFWAELQSLRQKHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRN
SLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM



DME EC Prediction for this protein is: 2.7.11.1
Check another protein