Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DGGMGTMIQ2.1.1.13;Methionine synthase. 34
  • Domain: Hcy-binding
  • Gene: METH
AGADIIETNTF2.1.1.13;Methionine synthase. 88
  • Domain: Hcy-binding
  • Gene: METH
VDILLIETIFDTANAKAALFA2.1.1.13;Methionine synthase. 188
  • Domain: Hcy-binding
  • Gene: METH
SGRTLSGQT2.1.1.13;Methionine synthase. 232
  • Domain: Hcy-binding
  • Gene: METH
GLNCALG2.1.1.13;Methionine synthase. 257
  • Metal Site C=Cysteine at location 260 on the protein
  • Metal Site Description: Zinc (By similarity).
  • Domain: Hcy-binding
  • Gene: METH
PNAGLPN2.1.1.13;Methionine synthase. 286
  • Domain: Hcy-binding
  • Gene: METH
IASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISL2.1.1.13;Methionine synthase. 435
  • Domain: Pterin-binding
  • Gene: METH
VVMAFDE2.1.1.13;Methionine synthase. 496
  • Domain: Pterin-binding
  • Gene: METH
DIIFDPNI2.1.1.13;Methionine synthase. 533
  • Domain: Pterin-binding
  • Gene: METH
SFSFRGMEAIREAMH2.1.1.13;Methionine synthase. 581
  • Domain: Pterin-binding
  • Gene: METH
MGIVNAG2.1.1.13;Methionine synthase. 609
  • Domain: Pterin-binding
  • Gene: METH
EERLEYALVKGIEK2.1.1.13;Methionine synthase. 672
  • Domain: B12-binding N-termin
  • Gene: METH
GKMFLPQV2.1.1.13;Methionine synthase. 726
  • Domain: B12-binding N-termin
  • Gene: METH
KSARVMK2.1.1.13;Methionine synthase. 735
  • Domain: B12-binding N-termin
  • Gene: METH
HLIPFME2.1.1.13;Methionine synthase. 746
  • Domain: B12-binding N-termin
  • Gene: METH
ATVKGDVHDIGKN2.1.1.13;Methionine synthase. 778
  • Metal Site H=Histidine at location 785 on the protein
  • Metal Site Description: Cobalt (cobalamin axial ligand
  • Domain: B12-binding
  • Gene: METH
GLSGLITPSLDEM2.1.1.13;Methionine synthase. 828
  • Binding Site S=Serine at location 830 on the protein
  • Binding site description: Cobalamin (By similarity).
  • Domain: B12-binding
  • Gene: METH
VAKEMER2.1.1.13;Methionine synthase. 843
  • Domain: B12-binding
  • Gene: METH
LDASKSVVVCS2.1.1.13;Methionine synthase. 884
  • Domain: B12-binding
  • Gene: METH
DWKPFFDVW2.1.1.13;Methionine synthase. 974
  • Binding Site D=Aspartic acid at location 974 on the protein
  • Binding site description: S-adenosyl-L-methionine (By si
  • Domain: AdoMet activation
TFYGLRQQ2.1.1.13;Methionine synthase. 1061
  • Domain: AdoMet activation
  • Gene: METH
DYLGLFA2.1.1.13;Methionine synthase. 1095
  • Domain: AdoMet activation
  • Gene: METH
DDYSSIM2.1.1.13;Methionine synthase. 1119
  • Domain: AdoMet activation
  • Gene: METH
DRLAEAFAE2.1.1.13;Methionine synthase. 1131
  • Domain: AdoMet activation
  • Gene: METH
GIRPAPGYP2.1.1.13;Methionine synthase. 1170
  • Binding Site R=Arginine at location 1172 on the protein
  • Binding site description: S-adenosyl-L-methionine; via c
  • Domain: AdoMet activation
  • Gene: METH
GYPSQPDHTEK2.1.1.13;Methionine synthase. 1176
  • Binding Site G=Glycine at location 1176 on the protein
  • Binding site description: Cobalamin; via carbonyl oxygen
  • Domain: AdoMet activation
  • Gene: METH
YFAVGKI2.1.1.13;Methionine synthase. 1227
  • Domain: AdoMet activation
  • Gene: METH

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSPALQDLSQPEGLKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHARPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSS
TSIAQADYGLEHLAYRMNMCSAGVARKAAEEVTLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQAKGLLDGG
VDILLIETIFDTA
NAKAALFA
LQNLFEEKYAPRPIFISGTIVDKSGRTLSGQTGEGFVISVSHGEPLCIGLNCALGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYDET
PSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATAFEGHMLLSGLEPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALC
VAKVQVEMGAQVLDVNMDDGMLDGPSAMTRFCNL
IASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDDFLEKARKIKKYGAAMVVMAF
DE
EGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHATKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLY
HAIKSGMD
MGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQTQGTGGKKVIQTDEWRNGPVEERLEYALVKGIEKHIIEDTEEARLNQKK
YPRPLNIIEGPLMNGMKIVGDLFGA
GKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTVEEEDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNN
FRVIDLGVMTPCDKILKAALDHKADII
GLSGLITPSLDEMIFVAKEMERLAIRIPLLIGGATTSKTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDEN
LKDEYFEEIMEEYEDIRQDHYESLKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQVFEDYDLQKLVDYI
DWKPFFDVWQLRGKYPNRGFPKIFNDK
TVGGEARKVYDDAHNMLNTLISQKKLRARGVVGFWPAQSIQDDIHLYAEAAVPQAAEPIA
TFYGLRQQAEKDSASTEPYYCLSDFIAPLHSGIRDYLGLF
A
VACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTG
IRLTESLAMAPASAVSGLYFSNLKSK
YFAVGKISKDQVEDYALRKNISVAEVEKWLGPILGYDTD



DME EC Prediction for this protein is: 2.1.1.13
Check another protein