Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
ALEYIVPC1.14.11;With 2-oxoglutarate as one donor 194 -
INGRTKAMVACYPGNG1.14.11;With 2-oxoglutarate as one donor 292
  • Domain: PKHD
GYVRHVDNP1.14.11;With 2-oxoglutarate as one donor 309
  • Metal Site H=Histidine at location 313 on the protein
  • Metal Site Description: Iron (By similarity).
  • Domain: PKHD
FDRLLFFWSDRRNPHEVQP1.14.11;With 2-oxoglutarate as one donor 360
  • Metal Site H=Histidine at location 374 on the protein
  • Metal Site Description: Iron (By similarity).
  • Domain: PKHD
TVWYFDA1.14.11;With 2-oxoglutarate as one donor 387
  • Domain: PKHD

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQGSEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARR
DNASGDAAKGKVKAKPPADPAAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLRPNGQTKPLPALKL
ALEYIVP
C
MNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMV
ACYPGNG
TGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAK
VKYLTGEKGVRVELNKPSDSVGKDVF



DME EC Prediction for this protein is: 1.14.11
Check another protein