Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data

Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DGHNDLP3.4.13.19;Membrane dipeptidase. 95
  • Metal Site H=Histidine at location 97 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
CASYSELELVTS3.4.13.19;Membrane dipeptidase. 168 -
GLTSFGEKVV3.4.13.19;Membrane dipeptidase. 246 -
APVIFSHS3.4.13.19;Membrane dipeptidase. 284
  • Metal Site H=Histidine at location 290 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
LQLLKKNGGIVMVT3.4.13.19;Membrane dipeptidase. 308 -
ANVSTVADHFDHI3.4.13.19;Membrane dipeptidase. 333 -
ELQGVLRGNLLRVFRQ3.4.13.19;Membrane dipeptidase. 392 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDL
PQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHS
LDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNL
LNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGN
LLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC


DME EC Prediction for this protein is: 3.4.13.19
Check another protein