Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SSLTGES3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 343 -
TGESIPV3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 346 -
VPPALPA3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 469 -
DKTGTLT3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 513
  • Active Site D=Aspartic acid at location 513 on the protein
  • Active Site Description: 4-aspartylphosphate intermedia
FPFSSALQRM3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 628 -
TGDNLQTA3.6.3.8;Calcium-transporting ATPase. 750 -
VFARMAP3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 850 -
VGMCGDGANDCGALK3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 873
  • Metal Site D=Aspartic acid at location 878 on the protein
  • Metal Site Description: Magnesium (By similarity).
ALKAADVGI3.6.3.5;Zinc-exporting ATPase. 885 -
FKYMALYS3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 934 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPWRVIGYHVVVWMMAGIPLLLFRWKPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSW
QLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAVSVGQKRVLRYYLFQGQRYIWIETQQAFYQVSLLDHGRSCDDVHRS
RHGLSLQDQMVRKAIYGPNVISIPVKSYPQLLVDEALNPYYGFQAFSIALWLADHYYWYALCIFLISSISICLSLYKTRKQSQTLRDMVKLSMRVCVCRP
GGEEEWVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMVNE
SSLTGESIPVLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRTGF
CTAKGGLVSSILHPRPINFKFYKHSMKFVAALSVLALLGTIYSIFILYRNRVPLNEIVIRALDLVTVV
VPPALPAAMTVCTLYAQSRLRRQGIFCIHPLR
INLGGKLQLVCF
DKTGTLTEDGLDVMGVVPLKGQAFLPLVPEPRRLPVGPLLRALATCHALSRLQDTPVGDPMDLKMVESTGWVLEEEPAADSAFGTQVL
AVMRPPLWEPQLQAMEEPPVPVSVLHR
FPFSSALQRMSVVVAWPGATQPEAYVKGSPELVAGLCNPETVPTDFAQMLQSYTAAGYRVVALASKPLPTVPS
LEAAQQLTRDTVEGDLSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMV
TGDNLQTAVTVARGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAV
NGVKDPDQAASYTVEPDPRSRHLALSGPTFGIIVKHFPKLLPKVLVQGT
VFARMAPEQKTELVCELQKLQYCVGMCGDGANDCGALKAADVGISLSQAEA
SVVSPFTSSMASIECVPMVIREGRCSLDTSFSV
FKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALVLGRVRPPGALLSVP
VLSSLLLQMVLVTGVQLGGYFLTLAQPWFVPLNRTVAAPDNLPNYENTVVFSLSSFQYLILAAAVSKGAPFRRPLYTNVPFLVALALLSSVLVGLVLVPG
LLQGPLALRNITDTGFKLLLLGLVTLNFVGAFMLESVLDQCLPACLRRLRPKRASKKRFKQLERELAEQPWPPLPAGPLR



DME EC Prediction for this protein is: 3.6.3.5
Check another protein