Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KVTSPYWEER3.1.2.15;Ubiquitin thiolesterase. 10
  • Gene: CYLD
FYLLLQECSVTDKQTQKLL3.1.2.15;Ubiquitin thiolesterase. 21
  • Gene: CYLD
VQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEG3.1.2.15;Ubiquitin thiolesterase. 133
  • Gene: CYLD
LLHINDIIP3.1.2.15;Ubiquitin thiolesterase. 296
  • Gene: CYLD
TGSTSDPG3.1.2.15;Ubiquitin thiolesterase. 340
  • Gene: CYLD
RNRSELFYTLNGSSVDSQ3.1.2.15;Ubiquitin thiolesterase. 349
  • Gene: CYLD
WYIDEVAEDPAKSLTE3.1.2.15;Ubiquitin thiolesterase. 375
  • Gene: CYLD
PVQESPP3.1.2.15;Ubiquitin thiolesterase. 453
  • Gene: CYLD
HGLEVGSLAEVKENPPFYGVIRWIGQPPGL3.1.2.15;Ubiquitin thiolesterase. 468
  • Gene: CYLD
LDTVLLRPKEKND3.1.2.15;Ubiquitin thiolesterase. 617
  • Gene: CYLD
EYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKV3.1.2.15;Ubiquitin thiolesterase. 631
  • Gene: CYLD
ILRVEPLLKIRSAGQKVQDC3.1.2.15;Ubiquitin thiolesterase. 693
  • Gene: CYLD

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELL
LAITNCEERFSLFKNRNRLSKGLQIDVGCPVK
VQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGVYQGKQLFQCDEDCGVFVALD
KLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTI
LLHIN
DIIP
ALSESVTQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRNRSELFYTLNGSSVDSQPQSKSKNTWYIDEVAEDPAKSLTEISTDFDRSSP
PLQPPPVNSLTTENRFHSLPFSLTKMPNTNGSIGHSPLSLSAQSVMEELNTA
PVQESPPLAMPPGNSHGLEVGSLAEVKENPPFYGVIRWIGQPPGLNEV
LAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNS
CYLDSTLFCLFAFSSV
LDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLL
KIRSAGQKVQDC
YFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECR
ECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNG
FNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK



DME EC Prediction for this protein is: 3.1.2.15
Check another protein