Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PHECRLRD2.7.7.6;DNA-directed RNA polymerase. 99
  • Gene: RPC2
LNECPLDPGGYF2.7.7.6;DNA-directed RNA polymerase. 158 -
EQLSKNRII2.7.7.6;DNA-directed RNA polymerase. 182
  • Gene: RPC2
SQFEKTRKV2.7.7.6;DNA-directed RNA polymerase. 457
  • Gene: RPC2
GPRSLQPSQWGMLCPSDTPEGEAC2.7.7.6;DNA-directed RNA polymerase. 467
  • Gene: RPC2
DGGRLCRP2.7.7.6;DNA-directed RNA polymerase. 588
  • Gene: RPC2
HNQSPRNTYQ2.7.7.6;DNA-directed RNA polymerase. 677 -
AMGKQAMG2.7.7.6;DNA-directed RNA polymerase. 688 -
GDKFSSR2.7.7.6;DNA-directed RNA polymerase. 894 -
SRHGQKGV2.7.7.6;DNA-directed RNA polymerase. 899 -
NPHGFPSRMT2.7.7.6;DNA-directed RNA polymerase. 930 -
YQKLKHMV2.7.7.6;DNA-directed RNA polymerase. 1009
  • Gene: RPC2
LTRQPTEGR2.7.7.6;DNA-directed RNA polymerase. 1031 -
EGRSRDGGLR2.7.7.6;DNA-directed RNA polymerase. 1037 -
GEMERDC2.7.7.6;DNA-directed RNA polymerase. 1048 -
ERLMISSDAFEVDVC2.7.7.6;DNA-directed RNA polymerase. 1066
  • Gene: RPC2
KLLFQEL2.7.7.6;DNA-directed RNA polymerase. 1111 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MDVLAEEFGNLTPEQLAAPIPTVEEKWRLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMKANEKVTSDADPMWYLKYLNIYVGLPDVEESFNVTRPVSPH
ECRLRD
MTYSAPITVDIEYTRGSQRIIRNALPIGRMPIMLRSSNCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILIQEQLSKNRIIVEADRKGAVG
ASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIFKAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQALKYIGNKVRRQRMWGGG
PKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAVMVRRVILAQGDNKVDDRDYYGNKRLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQF
DVVKHMRQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSRLSYISALGMMTRIS
SQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMT
HITTDMEDGPIVKLASNLGVEDVNLLCGEELSYPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAGYINEFVSISTNLTDRCVYISS
DGGRLCRPYIIVK
KQKPAVTNKHMEELAQGYRNFEDFLHESLVEYLDVNEENDCNIALYEHTINKDTTHLEIEPFTLLGVCAGLIPYPH
HNQSPRNTYQCAMGKQAMGTIGYN
QRNRIDTLMYLLAYPQKPMVKTKTIELIEFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLKRYTNQTFDKVMGPMLDAATR
KPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEI
GDKFSSR
HGQKGV
CGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGYNYLGKDYVTSGITGEPLEA
YIYFGPVY
YQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVCGQCGLLGYSGWCHYCKSSCH
VSSLRIPYAC
KLLFQELQSMNIIPRLKLSKYNE



DME EC Prediction for this protein is: 2.7.7.6
Check another protein