Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
FSIKIRRE3.4.11;Aminopeptidases. 203 -
STYLVAF3.4.11.3;Cystinyl aminopeptidase. 243 -
GAMENWG3.4.11;Aminopeptidases. 317 -
HELAHQWFG3.4.11;Aminopeptidases. 353
  • Active Site E=Glutamic acid at location 354 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 353 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
WFGNLVT3.4.11;Aminopeptidases. 359 -
WWNDLWLNE3.4.11;Aminopeptidases. 368 -
WLNEGFA3.4.11;Aminopeptidases. 373
  • Metal Site E=Glutamic acid at location 376 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
TWTLQKG3.4.11.3;Cystinyl aminopeptidase. 523 -
GYYIVHY3.4.11.3;Cystinyl aminopeptidase. 606 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVFLPLKWSLATMSFLLSSLLALLTVSTPSWCQSTEASPKRSDGTPFPWNKIRLPEYVIPVHYDLLIHANLTTLTFWGTTKVEITASQPTSTIILHSHHL
QISRATLRKGAGERLSEEPLQVLEHPRQEQIALLAPEPLLVGLPYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILASTQFEPTAARMAFPCFDEPAFK
AS
FSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTVKMSTYLVAFIISDFESVSKITKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIP
YPLPKQDLAAIPDFQS
GAMENWGLTTYRESALLFDAEKSSASSKLGITMTVAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVGDYF
FGKCFDAMEVDALNSSHPVSTPVENPAQIREMFDDVSYDKGACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNEDLWDSMASICPTDGVKGMDGFCSR
SQHSSSSSHWHQEGVDVKTMMN
TWTLQKGFPLITITVRGRNVHMKQEHYMKGSDGAPDTGYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKF
NVGMN
GYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFK
AFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFAVGAQSTEGWDFLYSKYQFSLSSTEKSQ
IEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKE
NGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM



DME EC Prediction for this protein is: 3.4.11.3
Check another protein