Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KTRKWSF3.6.1;In phosphorous-containing anhydrides. 368
  • Domain: HARP
  • Gene: SMAL1
LADDMGLGKT3.6.1;In phosphorous-containing anhydrides. 456
  • Domain: Helicase ATP-binding
MGLGKTIQ3.6.1;In phosphorous-containing anhydrides. 460
  • Domain: Helicase ATP-binding
EWPLLVV3.6.1;In phosphorous-containing anhydrides. 478
  • Domain: Helicase ATP-binding
  • Gene: SMAL1
LVVVPSS3.6.1;In phosphorous-containing anhydrides. 482
  • Domain: Helicase ATP-binding
PSSVRFTW3.6.1;In phosphorous-containing anhydrides. 486
  • Domain: Helicase ATP-binding
  • Gene: SMAL1
NIVSFDLL3.6.1;In phosphorous-containing anhydrides. 525
  • Domain: Helicase ATP-binding
  • Gene: SMAL1
DESHFLKN3.6.1;In phosphorous-containing anhydrides. 549
  • Domain: Helicase ATP-binding
  • Gene: SMAL1
LLSGTPAMSRPAELYTQI3.6.1;In phosphorous-containing anhydrides. 577
  • Domain: Helicase ATP-binding
  • Gene: SMAL1
PTFFPQFHAFGLRYC3.6.1;In phosphorous-containing anhydrides. 599
  • Domain: Helicase ATP-binding
  • Gene: SMAL1
PWGWDYS3.6.1;In phosphorous-containing anhydrides. 619
  • Gene: SMAL1
LRRLKSDV3.6.1;In phosphorous-containing anhydrides. 643 -
NRTAEAKI3.6.1;In phosphorous-containing anhydrides. 703
  • Gene: SMAL1
KFLVFAHH3.6.1;In phosphorous-containing anhydrides. 727
  • Domain: Helicase C-terminal
VAVLSITAA3.6.1;In phosphorous-containing anhydrides. 779
  • Domain: Helicase C-terminal
  • Gene: SMAL1
ELFWNPGVL3.6.1;In phosphorous-containing anhydrides. 803
  • Domain: Helicase C-terminal
  • Gene: SMAL1
EAGLSETNFSEMTE3.6.1;In phosphorous-containing anhydrides. 855
  • Domain: Helicase C-terminal
  • Gene: SMAL1
RFEFFDNWDSF3.6.1;In phosphorous-containing anhydrides. 940
  • Gene: SMAL1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSLPLTEEQRKKIEENRQKALARRAEKLLAEQHQRTSSGTSIAGNPFQAKQGPSQNFPRESCKPVSHGVIFKQQNLSSSSNADQRPHDSHSFQAKGIWKK
PEEMPTACPGHSPRSQMALTGISPPLAQSPPEVPKQQLLSYELGQGHAQASPEIRFTPFANPTHKPLAKPKSSQETPAHSSGQPPRDAKLEAKTAKASPS
GQNISYIHSSSESVTPRTEGRLQQKSGSSVQKGVNSQKGKCVRNGDRFQVLIGYNAELIAVFKTLPSKNYDPDTKTWNFSMNDYSALMKAAQSLPTVNLQ
PLEWAYGSSESPSTSSEGQAGLPSAPSLSFVKGRCMLISRAYFEADISYSQDLIALFKQMDSRRYDV
KTRKWSFLLEEHSKLIAKVRCLPQVQLDPLPTT
LTLAFASQLKKTSLSLTPDVPEADLSEVDPKLVSNLMPFQRAGVNFAIAKGGRLL
LADDMGLGKTIQAICIAAFYRKEWPLLVVVPSSVRFTWEQAFLRW
LPSLSPDCINVVVTGKDRLTAGLI
NIVSFDLLSKLEKQLKTPFKVVIIDESHFLKNSRTARCRAAMPVLKVAKRVILLSGTPAMSRPAELYTQIIAVKPT
FFPQFHAFGLRYC
DAKRMPWGWDYSGSSNLGELKLLLEEAVMLRRLKSDVLSQLPAKQRKIVVIAPGRINARTRAALDAAAKEMTTKDKTKQQQKDALIL
FF
NRTAEAKIPSVIEYILDLLESGREKFLVFAHHKVVLDAITQELERKHVQHIRIDGSTSSAEREDLCQQFQLSERHAVAVLSITAANMGLTFSSADLVV
FA
ELFWNPGVLIQAEDRVHRIGQTSSVGIHYLVAKGTADDYLWPLIQEKIKVLAEAGLSETNFSEMTESTDYLYKDPKQQKIYDLFQKSFEKEGSDMELL
EAAESFDPGSASGTSGSSSQNMGDTLDESSLTASPQKKR
RFEFFDNWDSFTSPL



DME EC Prediction for this protein is: 3.6.1
Check another protein