Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RYTPHPAYATF3.1.3.43;[Pyruvate dehydrogenase (acetyl-transferring)]-phosphatase. 45
  • Gene: PDP1
WWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPEF3.1.3.43;[Pyruvate dehydrogenase (acetyl-transferring)]-phosphatase. 62
  • Gene: PDP1
LPANAPIEDRRSA3.1.3.43;[Pyruvate dehydrogenase (acetyl-transferring)]-phosphatase. 117
  • Gene: PDP1
QAVSERLFYY3.1.3.43;[Pyruvate dehydrogenase (acetyl-transferring)]-phosphatase. 153 -
LRTYWQELIDLNTGES3.1.3.43;[Pyruvate dehydrogenase (acetyl-transferring)]-phosphatase. 212
  • Gene: PDP1
VAFSGATAC3.1.3.43;[Pyruvate dehydrogenase (acetyl-transferring)]-phosphatase. 267 -
PEVTYHRLRPQDKFLVLA3.1.3.43;[Pyruvate dehydrogenase (acetyl-transferring)]-phosphatase. 399 -
FLVLATDG3.1.3;Phosphoric monoester hydrolases. 412
  • Metal Site D=Aspartic acid at location 418 on the protein
  • Metal Site Description: Magnesium 2 (By similarity).
DQNAATHLIRHA3.1.3.43;[Pyruvate dehydrogenase (acetyl-transferring)]-phosphatase. 475 -
NAATHLIRH3.1.3;Phosphoric monoester hydrolases. 477 -
ARMYRDDIT3.1.3.43;[Pyruvate dehydrogenase (acetyl-transferring)]-phosphatase. 511 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSSSYIPQSRLRYTPHPAYATFCRPKENWWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPE
F
DGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYF
SKEASKLYFNS
LRTYWQELIDLNTGESTDIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVDGVDLHVANTGDSRAMLGVQE
EDGSWSAVTLSNDHNAQNERELERLKLEHPKSEAKSVVKQDRLLGLLMPFRAFGDVKFKWSIDLQKRVIESGPDQLNDNEYTKFIPPNYHTPPYLTAE
PE
VTYHRLRPQDKFLVLATDG
LWETMHRQDVVRIVGEYLTGMHHQQPIAVGGYKVTLGQMHGLLTERRTKMSSVFEDQNAATHLIRHAVGNNEFGTVDHERL
SKMLSLPEEL
ARMYRDDITIIVVQFNSHVVGAYQNQE



DME EC Prediction for this protein is: 3.1.3.43
Check another protein