Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
FIMACDQY1.3.1.21;7-dehydrocholesterol reductase. 57
  • Gene: DHCR7
DNWIPLLWC1.3.1.21;7-dehydrocholesterol reductase. 175
  • Gene: DHCR7
NILGYAVSTFA1.3.1.21;7-dehydrocholesterol reductase. 185
  • Gene: DHCR7
MGIEFNP1.3.1.21;7-dehydrocholesterol reductase. 221
  • Gene: DHCR7
KLFFNGRPGI1.3.1.21;7-dehydrocholesterol reductase. 236
  • Gene: DHCR7
WYLKTIDICHDHFGWYLGWGDCVWLP1.3.1.21;7-dehydrocholesterol reductase. 290
  • Gene: DHCR7
LYTLQGLYLVY1.3.1.21;7-dehydrocholesterol reductase. 317
  • Gene: DHCR7
IECSYTSADG1.3.1.21;7-dehydrocholesterol reductase. 378
  • Gene: DHCR7
SGFWGVARH1.3.1.21;7-dehydrocholesterol reductase. 397
  • Gene: DHCR7
HLLPYFY1.3.1;With NAD(+) or NADP(+) as acceptor. 426 -
AVPYRLLPG1.3.1.21;7-dehydrocholesterol reductase. 465
  • Gene: DHCR7

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAAKSQPNIPKAKSLDGVTNDRTASQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMACDQYSCALTGPVVDIVTGHARLSDIWAKTPPITRKAAQLY
TLWVTFQVLLYTSLPDFCHKFLPGYVGGIQEGAVTPAGVVNKYQINGLQAWLLTHLLWFANAHLLSWFSPTIIF
DNWIPLLWCANILGYAVSTFAMVKGY
FFPTSARDCKFTGNFFYNYM
MGIEFNPRIGKWFDFKLFFNGRPGIVAWTLINLSFAAKQRELHSHVTNAMVLVNVLQAIYVIDFFWNETWYLKTIDICHD
HFGWYLGWGDCVWLP
YLYTLQGLYLVYHPVQLSTPHAVGVLLLGLVGYYIFRVANHQKDLFRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFW
GVARH
FNYVGDLMGSLAYCLACGGGHLLPYFYIIYMAILLTHRCLRDEHRCASKYGRDWERYTAAVPYRLLPGIF



DME EC Prediction for this protein is: 1.3.1.21
Check another protein