Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
EELGKGAFS2.7.11.17;Calcium/calmodulin-dependent protein kinase. 17
  • Domain: Protein kinase
GKGAFSVVRRC2.7.11;Protein-serine/threonine kinases. 20
  • Domain: Protein kinase
AAKIINTKKL2.7.11.17;Calcium/calmodulin-dependent protein kinase. 40
  • Binding Site K=Lysine at location 42 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
QKLEREARICR2.7.11.17;Calcium/calmodulin-dependent protein kinase. 55
  • Domain: Protein kinase
NIVRLHD2.7.11;Protein-serine/threonine kinases. 71
  • Domain: Protein kinase
NIVRLHDSISEEG2.7.11.17;Calcium/calmodulin-dependent protein kinase. 71
  • Domain: Protein kinase
VTGGELF2.7.11;Protein-serine/threonine kinases. 92
  • Domain: Protein kinase
YSEADASHCIQQILE2.7.11.17;Calcium/calmodulin-dependent protein kinase. 107
  • Domain: Protein kinase
VVHRDLK2.7.11;Protein-serine/threonine kinases. 131
  • Active Site D=Aspartic acid at location 135 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
VHRDLKP2.7.11;Protein-serine/threonine kinases. 132
  • Active Site R=Arginine at location 134 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
VHRDLKPENLLLASK2.7.11.17;Calcium/calmodulin-dependent protein kinase. 132
  • Active Site D=Aspartic acid at location 135 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLKPEN2.7.11;Protein-serine/threonine kinases. 134
  • Active Site D=Aspartic acid at location 135 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
LKPENLL2.7.11;Protein-serine/threonine kinases. 136
  • Domain: Protein kinase
KGAAVKLADFGLAIEV2.7.11.17;Calcium/calmodulin-dependent protein kinase. 148
  • Domain: Protein kinase
VKLADFG2.7.11;Protein-serine/threonine kinases. 152
  • Domain: Protein kinase
LADFGLA2.7.11;Protein-serine/threonine kinases. 154
  • Binding Site D=Aspartic acid at location 156 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
QAWFGFAGTPGYLSPEVL2.7.11.17;Calcium/calmodulin-dependent protein kinase. 168
  • Domain: Protein kinase
PYGKPVD2.7.11;Protein-serine/threonine kinases. 189
  • Domain: Protein kinase
WACGVIL2.7.11;Protein-serine/threonine kinases. 197
  • Domain: Protein kinase
WACGVILYILLVGYPPFWDEDQH2.7.11.17;Calcium/calmodulin-dependent protein kinase. 197
  • Domain: Protein kinase
GVILYIL2.7.11;Protein-serine/threonine kinases. 200
  • Domain: Protein kinase
QIKAGAYD2.7.11.17;Calcium/calmodulin-dependent protein kinase. 224
  • Domain: Protein kinase
FPSPEWD2.7.11;Protein-serine/threonine kinases. 232
  • Domain: Protein kinase
PEAKDLI2.7.11;Protein-serine/threonine kinases. 242
  • Domain: Protein kinase
EALKHPWI2.7.11.17;Calcium/calmodulin-dependent protein kinase. 264
  • Domain: Protein kinase
CLKKFNARRKLKGAILTT2.7.11.17;Calcium/calmodulin-dependent protein kinase. 289 -
FNARRKL2.7.11;Protein-serine/threonine kinases. 293 -
TTIEDED2.7.11.17;Calcium/calmodulin-dependent protein kinase. 336 -
RKQEIIK2.7.11.17;Calcium/calmodulin-dependent protein kinase. 346 -
TEQLIEA2.7.11.17;Calcium/calmodulin-dependent protein kinase. 354 -
FEPEALGNLVEG2.7.11.17;Calcium/calmodulin-dependent protein kinase. 380 -
DFHRFYFEN2.7.11.17;Calcium/calmodulin-dependent protein kinase. 393 -
QSEETRVWH2.7.11.17;Calcium/calmodulin-dependent protein kinase. 448 -
HFHRSGAPSV2.7.11.17;Calcium/calmodulin-dependent protein kinase. 466 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFED
IVAREY
YSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACG
VILYILLVGYPPFWDEDQH
RLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTT
MLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFE
N
LWSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH



DME EC Prediction for this protein is: 2.7.11.17
Check another protein